H00055104-B01P FLJ10246 antibody

See related secondary antibodies

Search for all "FLJ10246"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FLJ10246

H00055104-B01P

Product Description for FLJ10246

Mouse anti Human FLJ10246.
Product is tested for Western blot / Immunoblot.

Properties for FLJ10246

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
FLJ10246 (ENSP00000333479, 1 a.a. ~ 153 a.a) full-length human protein.
AA Sequence:
MSWTFEYFVTKLDAVKILWKIFLVFWFHFSGQLTWLGSDCLCGLWIQFELTFQNLRIAVQVPGVPSMPLCSSQRLS SAALGQFTHGHVGGKLEIVYTNLEDVSSLRDFPCTQAPKSFFSWFFGEKTGILASLCFSYVFCRGAHFLNKMEREK S
GeneID:
55104
Add. information Mouse polyclonal antibody raised against a full-length human FLJ10246 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn