H00201283-B01P FLJ32065 antibody

See related secondary antibodies

Search for all "FLJ32065"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human FLJ32065

H00201283-B01P

Product Description for FLJ32065

Mouse anti Human FLJ32065.
Product is tested for Western blot / Immunoblot.

Properties for FLJ32065

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp686D22101, MGC90301
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
FLJ32065 (XP_001134063.1, 1 a.a. ~ 154 a.a) full-length human protein.
AA Sequence:
MSRVSGVEACWVRAVRRCCQSWAGQPGRRGGRQSRSVERDEDVGGTDVAEAAGTAGAECLWGAREAFPEAPGGRRG EARVPGEALLHPQPEPGLCLHGPEPTVRVAVGNQLGWPTSPGWPEMFWFWDHSVPGLQPTTVTILCAPCPSSPAAS LD
GeneID:
201283
Add. information Mouse polyclonal antibody raised against a full-length human FLJ32065 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn