discontinued

NBP1-56798 FLJ40504 antibody

See related secondary antibodies

Search for all "FLJ40504"

50 µg / €440.00

Quick Overview

Rabbit anti Human FLJ40504

Product Description for FLJ40504

Rabbit anti Human FLJ40504.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FLJ40504

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC138231, MGC138233
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Immunogen:
Synthetic peptides corresponding to FLJ40504(hypothetical protein FLJ40504) The peptide sequence was selected from the N terminal of FLJ40504. Peptide sequence MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL.
Background The specific function of FFLJ40504 is not yet known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 284085

Accessory Products

  • LinkedIn