NBP1-56798 FLJ40504 antibody

See related secondary antibodies

Search for all "FLJ40504"

50 µg / €440.00

Quick Overview

Rabbit anti Human FLJ40504

Product Description for FLJ40504

Rabbit anti Human FLJ40504.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FLJ40504

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC138231, MGC138233
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Synthetic peptides corresponding to FLJ40504(hypothetical protein FLJ40504) The peptide sequence was selected from the N terminal of FLJ40504. Peptide sequence MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL.
Background The specific function of FFLJ40504 is not yet known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 284085

Accessory Products

  • LinkedIn