discontinued

H00284085-B01P FLJ40504 purified MaxPab mouse antibody

See related secondary antibodies

Search for all "FLJ40504 purified MaxPab mouse"

50 µg / €370.00

Quick Overview

Mouse anti Human FLJ40504 purified MaxPab mouse

Product Description for FLJ40504 purified MaxPab mouse

Mouse anti Human FLJ40504 purified MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for FLJ40504 purified MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC138231, MGC138233, hypothetical protein FLJ40504
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
FLJ40504 (NP_775895.1, 1 a.a. ~ 259 a.a) full-length human protein.
AA Sequence:
MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQLPVPGHCPGTQLCAQLVSSVASVYAGI RGSGSRISMSCFTSFQGSMGSRGLPAVMAGGLAGMGVIQNEKETMQSLNDHLASYLDRVRSLDTKNWKLESQEHLE KKGPQVRDWSHDFKTIENLRAQIFANTVDSAHIVLQIDNACLAGDDFRVKYETELAMCQSVESDIHGLHKVIDDTN VTWLQLEAEIKALKEKLLFMKKNHEEEVKGL
Remarks:
Gene Accession: NM_173624.1
Add. information Mouse polyclonal antibody raised against a full-length human FLJ40504 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 284085

Accessory Products

  • LinkedIn