discontinued

NBP1-91907 FLJ44048 antibody

See related secondary antibodies

Search for all "FLJ44048"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human FLJ44048

Product Description for FLJ44048

Rabbit anti Human FLJ44048.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for FLJ44048

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13H15
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SQMEPSSISILKENIVASEIIGTLMDQCTYFNESLIQNLSRESLFQGAENAYTVNQVELATNMKMFTSKLKEGSLGINPSQVSKTGFVFCSDEDMKEKY
GeneID:
4010240
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 4010240

Accessory Products

  • LinkedIn