NBP1-57997 Follistatin antibody

See related secondary antibodies

Search for all "Follistatin"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Follistatin

Product Description for Follistatin

Rabbit anti Human Follistatin.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Follistatin

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FS
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FST(follistatin) The peptide sequence was selected from the middle region of FST. Peptide sequence ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN.
Background Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 10468

Accessory Products

  • LinkedIn