TA330241 FOXE3 / FKHL12 antibody

Rabbit Polyclonal Anti-FOXE3 Antibody

See related secondary antibodies

Search for all "FOXE3 / FKHL12"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FOXE3 / FKHL12


More Views

  • TA330241
  • TA330241

Product Description for FOXE3 / FKHL12

Rabbit anti Human FOXE3 / FKHL12.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FOXE3 / FKHL12

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FREAC8, Forkhead box protein E3, Forkhead-related protein FKHL12, Forkhead-related transcription factor 8
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-FOXE3 antibody: synthetic peptide directed towards the C terminal of human FOXE3. Synthetic peptide located within the following region: PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAE.
Application WB
Background Forkhead Box Protein E3 (FOXE3, forkhead-related protein FKHL12, forkhead-related transcription factor 8) is a forkhead/winged helix transcription factor, which is expressed in the developing lens from the start of lens placode induction and becomes restricted to the anterior proliferating cells when lens fiber differentiation begins.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn