F-MKA1041AF FOXJ3 antibody

See related secondary antibodies

Search for all "FOXJ3"

50 µg / €680.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse FOXJ3

F-MKA1041AF

Product Description for FOXJ3

Rabbit anti Mouse FOXJ3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXJ3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Germany only
PDF datasheet View Datasheet
Manufacturer Funakoshi Co., Ltd.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8BUR3
Immunogen:
GX2004 (GST-fusion protein, 225 amino acids)QHPAPHPQQHSQLQPPHSQHPPPHQHIQHHPNHQHQTLAHQPPPPPQQVSCNSGVSSDWYATLDMLKESCRIASSVNWSDVDLSQFQGLMESMRQADLKNWSLDQVQFADLCSSLNQFFTQTGLIHSQSNVPQNVCHGAMHPAKPSQHIGAGNLYIDSRQSLPPSVMPPPGYPHIPQALNTPGTTMAGHHGAMNQQHMMPSQAFPMRRPLPPDDIQDDFDWDSIV.
GeneID:
230700
Add. information Shipping conditions: Dry Ice
Storage -20℃
Format
State:
Aff - Purified

Accessory Products

  • LinkedIn