NBP1-69031 FOXL2 antibody

See related secondary antibodies

Search for all "FOXL2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat FOXL2

NBP1-69031

Product Description for FOXL2

Rabbit anti Rat FOXL2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FOXL2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3SHS5
Immunogen:
Synthetic peptides corresponding to Foxl2 (forkhead box L2) The peptide sequence was selected from the C terminal of Foxl2. Peptide sequence SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD.
GeneID:
3671520
Background The function of Foxl2 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3671520

Accessory Products

  • LinkedIn