discontinued

H00002308-M07 FOXO1A antibody

See related secondary antibodies

Search for all "FOXO1A"

Quick Overview

Mouse anti Human FOXO1A 1F6

Product Description for FOXO1A

Mouse anti Human FOXO1A 1F6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for FOXO1A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms FKHR, FOXO1, Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead in Rhabdomyosarcoma
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1F6
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12778
Immunogen:
FOXO1A (NP_002006, 556 a.a. ~ 656 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFN FDNVLPNQSFPHSVKTTTHSWVSG*
GeneID:
2308
Remarks:
Gene Accession: NM_002015
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant FOXO1A.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2308

Accessory Products

Proteins and/or Positive Controls

Proteins for FOXO1A (3 products)

Catalog No. Species Pres. Purity   Source  

FOXO1A

FOXO1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

FOXO1A

FOXO1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FOXO1A

FOXO1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FOXO1A (2 products)

Catalog No. Species Pres. Purity   Source  

FOXO1A Lysate

Western Blot: FOXO1A Lysate [NBL1-10813] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FOXO1
  Novus Biologicals Inc.

FOXO1 overexpression lysate

FOXO1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn