discontinued

H00002271-M01 Fumarase antibody

See related secondary antibodies

Search for all "Fumarase"

Quick Overview

Mouse anti Human Fumarase 2E10

H00002271-M01

More Views

  • H00002271-M01

Product Description for Fumarase

Mouse anti Human Fumarase 2E10.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Fumarase

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms HLRCC, LRCC, MCL, MCUL1, mitochondrial Fumarate hydratase
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2E10
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P07954
Immunogen:
FH (AAH03108, 33 a.a. ~ 511 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
VPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKS QSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMT RIKAAMPRIYELAAGGTAVGTGLNTRI
GeneID:
2271
Remarks:
Gene Accession: BC003108
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a full-length recombinant FH.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2271

Accessory Products

Proteins and/or Positive Controls

Proteins for Fumarase (7 products)

Catalog No. Species Pres. Purity   Source  

Fumarase

Fumarase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Fumarase

Fumarase Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €399.00
  OriGene Technologies, Inc.

Fumarase (44-510)

Fumarase Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €540.00
  OriGene Technologies GmbH

Fumarase (44-510)

Fumarase Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €230.00
  OriGene Technologies GmbH

Fumarase

Fumarase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Fumarase

Fumarase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Fumarase

Western Blot: Fumarase Protein NBC1-18871 Protein
  Novus Biologicals Inc.

Positive controls for Fumarase (1 products)

Catalog No. Species Pres. Purity   Source  

Fumarase Lysate

Western Blot: Fumarase Lysate [NBL1-10713] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FH
  Novus Biologicals Inc.
  • LinkedIn