
NBP1-52830 FXR antibody

See related secondary antibodies

Search for all "FXR"

Quick Overview

Rabbit anti Human FXR

Product Description for FXR

Rabbit anti Human FXR.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for FXR

Product Category Primary Antibodies
Quantity 50 µg
Synonyms BAR, FXR, HRR-1, HRR1, MGC163445, RIP14
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to NR1H4(nuclear receptor subfamily 1, group H, member 4) The peptide sequence was selected from the middle region of NR1H4. Peptide sequence SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI.
Background NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression, via two d
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 9971

Accessory Products

  • LinkedIn