discontinued

H00002553-D01P GABPB1 antibody

See related secondary antibodies

Search for all "GABPB1"

Quick Overview

Rabbit anti Human GABPB1

Product Description for GABPB1

Rabbit anti Human GABPB1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for GABPB1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms E4TF1-47, E4TF1-53, E4TF1B, GA-binding protein subunit beta-1, GABP subunit beta-2, GABPB, GABPB-2, GABPB2, Nuclear respiratory factor 2, Nuclear respiratory factor 2, Transcription factor E4TF1-47, Transcription factor E4TF1-53
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q06547
Immunogen:
GABPB1 (NP_005245.2, 1 a.a. ~ 395 a.a) full-length human protein.
AA Sequence:
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRAGVSRDARTKVDRTPLH MAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNEDL AEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSENSSKATDETGVSAVQFGNSSTSVLATLA ALAEASAPLSNSSETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVTMPDG QQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQ KLEAMTRLQTNKEAV
GeneID:
2553
Remarks:
Gene Accession: NM_005254.4
Add. information Rabbit polyclonal antibody raised against a full-length human GABPB1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2553

Accessory Products

Proteins and/or Positive Controls

Proteins for GABPB1 (12 products)

Catalog No. Species Pres. Purity   Source  

GABPB1 (full length, N-term HIS tag, transcript variant gamma-1)

GABPB1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

GABPB1 (full length, N-term HIS tag, transcript variant beta-1)

GABPB1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

GABPB1

GABPB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GABPB1

GABPB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GABPB1

GABPB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GABPB1

GABPB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % 6xHis tag / Immobilized-metal affinity chromatography (IMAC) E. coli
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % 6xHis tag / Immobilized-metal affinity chromatography (IMAC) E. coli
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % 6xHis tag / Immobilized-metal affinity chromatography (IMAC) E. coli
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % GST tag / affinity chromatography Sf9-Baculovirus
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % GST tag / affinity chromatography Sf9-Baculovirus
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % GST tag / affinity chromatography Sf9-Baculovirus
  Protein Alternatives

Positive controls for GABPB1 (6 products)

Catalog No. Species Pres. Purity   Source  

GABPB1 Lysate

Western Blot: GABPB1 Lysate [NBL1-10912] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GABPB1
  Novus Biologicals Inc.

GABPB1 Lysate

Western Blot: GABPB1 Lysate [NBL1-10913] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GABPB1
  Novus Biologicals Inc.

GABPB1 Lysate

Western Blot: GABPB1 Lysate [NBL1-10914] - Western Blot experiments. Left-Control; Right -Over-expression Lysate for GABPB1.
  Novus Biologicals Inc.

GABPB1 overexpression lysate

GABPB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GABPB1 overexpression lysate

GABPB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GABPB2 293T Cell Transient Overexpression Lysate(Denatured)

GABPB2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn