TA344563 GABPB1 antibody

Rabbit Polyclonal Anti-GABPB2 Antibody - N-terminal region

See related secondary antibodies

Search for all "GABPB1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GABPB1

Product Description for GABPB1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GABPB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GABPB1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms E4TF1-47, E4TF1-53, E4TF1B, GA-binding protein subunit beta-1, GABP subunit beta-2, GABPB, GABPB-2, GABPB2, Nuclear respiratory factor 2, Nuclear respiratory factor 2, Transcription factor E4TF1-47, Transcription factor E4TF1-53
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q06547
Immunogen:
The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the N terminal of human GABPB2. Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH.
GeneID:
2553
Application WB
Background GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a terry protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a terry protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GABPB1 (12 products)

Catalog No. Species Pres. Purity   Source  

GABPB1 (full length, N-term HIS tag, transcript variant gamma-1)

GABPB1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

GABPB1 (full length, N-term HIS tag, transcript variant beta-1)

GABPB1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

GABPB1

GABPB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GABPB1

GABPB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GABPB1

GABPB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GABPB1

GABPB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % 6xHis tag / Immobilized-metal affinity chromatography (IMAC) E. coli
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % 6xHis tag / Immobilized-metal affinity chromatography (IMAC) E. coli
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % 6xHis tag / Immobilized-metal affinity chromatography (IMAC) E. coli
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % GST tag / affinity chromatography Sf9-Baculovirus
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % GST tag / affinity chromatography Sf9-Baculovirus
  Protein Alternatives

GABPB1 (1-395, Full Length)

Human GABPB1 recombinant protein Human Purified > 90 % GST tag / affinity chromatography Sf9-Baculovirus
  Protein Alternatives

Positive controls for GABPB1 (6 products)

Catalog No. Species Pres. Purity   Source  

GABPB1 Lysate

Western Blot: GABPB1 Lysate [NBL1-10912] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GABPB1
  Novus Biologicals Inc.

GABPB1 Lysate

Western Blot: GABPB1 Lysate [NBL1-10913] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GABPB1
  Novus Biologicals Inc.

GABPB1 Lysate

Western Blot: GABPB1 Lysate [NBL1-10914] - Western Blot experiments. Left-Control; Right -Over-expression Lysate for GABPB1.
  Novus Biologicals Inc.

GABPB1 overexpression lysate

GABPB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GABPB1 overexpression lysate

GABPB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GABPB2 293T Cell Transient Overexpression Lysate(Denatured)

GABPB2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn