discontinued

NBP1-53133 Galectin 8 antibody

See related secondary antibodies

Search for all "Galectin 8"

50 µg / €390.00

Quick Overview

Rabbit anti Human Galectin 8

Product Description for Galectin 8

Rabbit anti Human Galectin 8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Galectin 8

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Gal-8, PCTA-1, PCTA1, Po66-CBP
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXC8
Immunogen:
Synthetic peptides corresponding to LGALS8(lectin, galactoside-binding, soluble, 8 (galectin 8)) The peptide sequence was selected from the C terminal of LGALS8. Peptide sequence FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD.
GeneID:
3964
Background LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3964

Accessory Products

  • LinkedIn