TA338482 GALNT11 antibody

Rabbit Polyclonal Anti-Galnt11 Antibody

See related secondary antibodies

Search for all "GALNT11"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GALNT11

Product Description for GALNT11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GALNT11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GALNT11

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms GalNAc-T11, Polypeptide GalNAc transferase 11, Polypeptide N-acetylgalactosaminyltransferase 11, Protein-UDP acetylgalactosaminyltransferase 11, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11, pp-GaNTase 11
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P6V1
Immunogen:
The immunogen for anti-Galnt11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYP.
GeneID:
311952
Application WB
Background The function of Galnt11 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn