
NBP1-74244 GALNT3 antibody

See related secondary antibodies

Search for all "GALNT3"

Quick Overview

Rabbit anti Rat GALNT3


Product Description for GALNT3

Rabbit anti Rat GALNT3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GALNT3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the N terminal of Galnt3. Immunizing peptide sequence PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE.
Background The function remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified
Gene ID 366061

Accessory Products

  • LinkedIn