NBP1-54399 GAMT antibody

See related secondary antibodies

Search for all "GAMT"

Quick Overview

Rabbit anti Human GAMT

Product Description for GAMT

Rabbit anti Human GAMT.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GAMT

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PIG2, TP53I2
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to GAMT(guanidinoacetate N-methyltransferase) The peptide sequence was selected from the middle region of GAMT. Peptide sequence PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI.
Background GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumula
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 2593

Accessory Products

  • LinkedIn