NBP1-54399 GAMT antibody

See related secondary antibodies

Search for all "GAMT"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GAMT

Product Description for GAMT

Rabbit anti Human GAMT.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GAMT

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PIG2, TP53I2
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to GAMT(guanidinoacetate N-methyltransferase) The peptide sequence was selected from the middle region of GAMT. Peptide sequence PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI.
Background GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumula
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 2593

Accessory Products

  • LinkedIn