TA337317 GATSL3 antibody

Rabbit Polyclonal Anti-GATSL3 Antibody

See related secondary antibodies

Search for all "GATSL3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GATSL3

Product Description for GATSL3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GATSL3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GATSL3

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms GATS-like protein 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WTX7
Immunogen:
The immunogen for Anti-GATSL3 antibody is: synthetic peptide directed towards the C-terminal region of Human GATSL3. Synthetic peptide located within the following region: EPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGG.
GeneID:
652968
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GATSL3 (3 products)

Catalog No. Species Pres. Purity   Source  

GATSL3

GATSL3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GATSL3

GATSL3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GATSL3

GATSL3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GATSL3 (2 products)

Catalog No. Species Pres. Purity   Source  

GATSL3 Lysate

Western Blot: GATSL3 Lysate [NBL1-12624] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GATSL3
  Novus Biologicals Inc.

GATSL3 overexpression lysate

GATSL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn