H00388646-B01P GBP7 antibody

See related secondary antibodies

Search for all "GBP7"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human GBP7

H00388646-B01P

Product Description for GBP7

Mouse anti Human GBP7.
Product is tested for Western blot / Immunoblot.

Properties for GBP7

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ38822, GBP4L
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N8V2
Immunogen:
GBP7 (AAI56124.1, 1 a.a. ~ 638 a.a) full-length human protein.
AA Sequence:
MASEIHMPGPVCLTENTKGHLVVNSEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFPLGCTVKSETK GIWMWCVPHPSKPNHTLILLDTEGLGDMEKSDPKSDSWIFALAVLLSSSFVYNSMGTINHQALEQLHYVTELTELI RAKSCPRPDEVEDSSEFVSFFPDFIWTVRDFTLELKLDGHPITEDEYLENALKLISGKNPQIQNSNKPREWIRHFF PKQKCFVFDRPINDKKLLLHVEEVREDQLDSNFQMQSENFCSYIFTHAKTKTLREGILVTGNRLGMLVETYLDAIN SGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQVRFPTDTLQELLDVHAVCEREAIAVFMEYSFKDKSQEFQ KKLVDTMEKKKEDFVLQNEEASAKYCQAELKRLSELLTESISRGTFFVPGGHNIYLEAKKKIEQDYTLVPRKGVKA DEVLQSFLQSQVVIEESILQSDKALTAGEKAIAAKQAKKEAAEKEQELLRQKQKEQQQMMEAQERSFQENIAQLKK KMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAAENEEPSVFSQILDVAGSIFIAAL PGAAKLVDLGMKILSSLCNRLRNPGKKIIS
GeneID:
388646
Add. information Mouse polyclonal antibody raised against a full-length human GBP7 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for GBP7 (1 products)

Catalog No. Species Pres. Purity   Source  

Guanylate binding protein 7 (GBP7)

Guanylate binding protein 7 (GBP7) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for GBP7 (1 products)

Catalog No. Species Pres. Purity   Source  

GBP7 overexpression lysate

GBP7 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn