discontinued

H00094104-B01P GCFC antibody

See related secondary antibodies

Search for all "GCFC"

Quick Overview

Mouse anti Human GCFC

H00094104-B01P

More Views

  • H00094104-B01P

Product Description for GCFC

Mouse anti Human GCFC.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for GCFC

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C21orf66, GC-rich sequence DNA-binding factor homolog
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5B6
Immunogen:
C21orf66 (AAH30539.1, 1 a.a. ~ 398 a.a) full-length human protein.
AA Sequence:
MFRKARRVNVRKRNDSEEEERERDEEQEPPPLLPPPGTGEEAGPGGGDRAPGGESLLGPGPSPPSALTPGLGAEAG GGFPGGAEPGNGLKPRKRPRENKEVPRASLLSFQDEEEENEEVFKVKKSSYSKKIVKLLKKEYKEDLEKSKIKTEL NSSAESEQPLDKTGHVKDTNQEDGVIISEHGEDEMDMESEKEEEKPKTGGAFSNALSSLNVLRPGEIPDAAFIHAA RKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEKSQRQKIAEEIGIEGSDDDALVTGE QDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNTYQTMPYGSSYGIPYSYTAYGSSDAKSQKTDNTVPFKTPS NEMTPVTIDLVKKQLKDR
GeneID:
94104
Remarks:
Gene Accession: BC030539.1
Add. information Mouse polyclonal antibody raised against a full-length human C21orf66 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 94104

Accessory Products

Proteins and/or Positive Controls

Proteins for GCFC (2 products)

Catalog No. Species Pres. Purity   Source  

GCFC

GCFC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GCFC

GCFC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GCFC (1 products)

Catalog No. Species Pres. Purity   Source  

C21orf66 293T Cell Transient Overexpression Lysate(Denatured)

C21orf66 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn