NBP1-52913 GEM antibody

See related secondary antibodies

Search for all "GEM"

Quick Overview

Rabbit anti Human, Mouse, Rat GEM

Product Description for GEM

Rabbit anti Human, Mouse, Rat GEM.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GEM

Product Category Primary Antibodies
Quantity 50 µg
Synonyms p97
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to GEMIN4(gem (nuclear organelle) associated protein 4) The peptide sequence was selected from the N terminal of GEMIN4. Peptide sequence QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR.
Background The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes requi
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 50628

Accessory Products

  • LinkedIn