TA339370 GINS4 / SLD5 antibody

Rabbit Polyclonal Anti-GINS4 Antibody

See related secondary antibodies

Search for all "GINS4 / SLD5"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine GINS4 / SLD5

Product Description for GINS4 / SLD5

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine GINS4 / SLD5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GINS4 / SLD5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DNA replication complex GINS protein SLD5, GINS complex subunit 4
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-GINS4 antibody is: synthetic peptide directed towards the N-terminal region of Human GINS4. Synthetic peptide located within the following region: TEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIV.
Application WB
Background The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of D replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additiol information about the GINS complex.[supplied by OMIM, Mar 2008]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordites used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combition :: AK095334.1, BC005995.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025087, ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for GINS4 / SLD5 (4 products)

Catalog No. Species Pres. Purity   Source  


GINS4 / SLD5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GINS4 / SLD5 (1-223, His-tag)

GINS4 / SLD5 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

GINS4 / SLD5 (1-223, His-tag)

GINS4 / SLD5 Human Purified > 90 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH


GINS4 / SLD5 Human
  Abnova Taiwan Corp.

Positive controls for GINS4 / SLD5 (2 products)

Catalog No. Species Pres. Purity   Source  

GINS4 Lysate

Western Blot: GINS4 Lysate [NBL1-11079] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GINS4
  Novus Biologicals Inc.

GINS4 overexpression lysate

GINS4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn