
NBP1-59080 GITRL antibody

See related secondary antibodies

Search for all "GITRL"

Quick Overview

Rabbit anti Human GITRL

Product Description for GITRL

Rabbit anti Human GITRL.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GITRL

Product Category Primary Antibodies
Quantity 50 µg
Synonyms AITRL, GITRL, MGC138237, TL6, hGITRL
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to TNFSF18(tumor necrosis factor (ligand) superfamily, member 18) The peptide sequence was selected from the middle region of TNFSF18. Peptide sequence KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN.
Background TNFSF18 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-662 BC112032.1 1-662 663-748 AY358868.1 616-701
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 8995

Accessory Products

  • LinkedIn