H00125111-B01P GJD3 antibody

See related secondary antibodies

Search for all "GJD3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human GJD3

H00125111-B01P

Product Description for GJD3

Mouse anti Human GJD3.
Product is tested for Western blot / Immunoblot.

Properties for GJD3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms CX31.9, Cx30.2, GJA11, GJC1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZUW6
Immunogen:
GJD3 (AAI53090.1, 1 a.a. ~ 295 a.a) full-length human protein.
AA Sequence:
MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYR FWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLG GQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCN RAHEEAQKLLPPPPPPPIVVTWEENRHLQGEGSPGSPHPKTELDAPRFRRESTSPAGWHCSLPFHGT
GeneID:
125111
Add. information Mouse polyclonal antibody raised against a full-length human GJD3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn