AP02098SU-N GLP2 antibody

See related secondary antibodies

Search for all "GLP2"

0.1 ml / €640.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GLP2

AP02098SU-N

Product Description for GLP2

Rabbit anti Human GLP2.
Presentation: Serum
Product is tested for Enzyme Immunoassay.

Properties for GLP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Glucagon like peptide 2
Presentation Serum
Reactivity Hu
Applications E
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Immunogen:
Synthetic human GLP-2, KLH-conjugated
AA Sequence:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Add. information LocusID 2641
Application ELISA (1/3000).
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
State:
Lyophilized crude serum
Serum
Reconstitution:
Restore in aqua bidest to initial volume.
Specificity
Specificity:
This antibody detects GLP-2.
Species:
Human.

Accessory Products

  • LinkedIn