H00080772-B01P GLTPD1 antibody

See related secondary antibodies

Search for all "GLTPD1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human GLTPD1

H00080772-B01P

Product Description for GLTPD1

Mouse anti Human GLTPD1.
Product is tested for Western blot / Immunoblot.

Properties for GLTPD1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC10334
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TA50
Immunogen:
GLTPD1 (AAH04366.1, 1 a.a. ~ 221 a.a) full-length human protein.
AA Sequence:
MCPHLRPVPGTPCLPRWAALSPGDSVPSMPWLAETLNSSLGTVGLSPPLLPCLPLSVPGRLGAGQPEAETKAPHRR AQEVPALGTASSVAPARHQFPEGRSRPPPAAAVGLHSPAQPKAPRSWDSATPSEMLCPFSPVPLDAPSPQCSGDPW GTEQEGLDPVAQPKATRQPQPAQPPSSAWGLATGSSQWTPAPRGGRGTAPTAQQTCELPECNLCDVFQR
GeneID:
80772
Add. information Mouse polyclonal antibody raised against a full-length human GLTPD1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for GLTPD1 (2 products)

Catalog No. Species Pres. Purity   Source  

GLTPD1 (1-214, His-tag)

GLTPD1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €730.00
  Acris Antibodies GmbH

GLTPD1 (1-214, His-tag)

GLTPD1 Human Purified > 90 % by SDS - PAGE E. coli
20 µg / €300.00
  Acris Antibodies GmbH
  • LinkedIn