NBP1-90542 glutamine rich 2 antibody

See related secondary antibodies

Search for all "glutamine rich 2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human glutamine rich 2

Product Description for glutamine rich 2

Rabbit anti Human glutamine rich 2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for glutamine rich 2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0J4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LPGHHSIRPYTVFELEQVRQHSRNLKLGSAFPRGDLAQMEQSVGRLRSMHSKMLMNIEKVQIHFGGSTKASSQIIRELLHAQCLGSPCYKRVTDMADYTYSTVPR
GeneID:
84074
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84074

Accessory Products

Proteins and/or Positive Controls

Positive controls for glutamine rich 2 (1 products)

Catalog No. Species Pres. Purity   Source  

QRICH2 overexpression lysate

QRICH2 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn