NBP1-57033 Glycerol kinase antibody

See related secondary antibodies

Search for all "Glycerol kinase"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Glycerol kinase


Product Description for Glycerol kinase

Rabbit anti Human Glycerol kinase.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Glycerol kinase

Product Category Primary Antibodies
Quantity 50 µg
Synonyms GK1, GKD
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to GK (glycerol kinase) The peptide sequence was selected from the middle region of GK. Peptide sequence MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS.
Background The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 2710

Accessory Products

  • LinkedIn