NBP1-57033 Glycerol kinase antibody

See related secondary antibodies

Search for all "Glycerol kinase"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Glycerol kinase

NBP1-57033

Product Description for Glycerol kinase

Rabbit anti Human Glycerol kinase.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Glycerol kinase

Product Category Primary Antibodies
Quantity 50 µg
Synonyms GK1, GKD
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NJP5
Immunogen:
Synthetic peptides corresponding to GK (glycerol kinase) The peptide sequence was selected from the middle region of GK. Peptide sequence MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS.
GeneID:
2710
Background The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 2710

Accessory Products

  • LinkedIn