NBP1-74203 Gm13178 antibody

See related secondary antibodies

Search for all "Gm13178"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse Gm13178

NBP1-74203

Product Description for Gm13178

Rabbit anti Mouse Gm13178.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Gm13178

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B1AVU7
Immunogen:
Synthetic peptides corresponding to the C terminal of Gm13178. Immunizing peptide sequence TFLVSCEHDVLRDDALLYKKRLEDQGVPVSWYHAEDGFHGCISLFDKQPF.
GeneID:
546849
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
State:
Aff - Purified
Gene ID 546849

Accessory Products

  • LinkedIn