
TA334364 Gm13194 antibody

See related secondary antibodies

Search for all "Gm13194"

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Yeast Gm13194

Product Description for Gm13194

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Yeast Gm13194.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Gm13194

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Can, Eq, GP, Hu, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

The immunogen for anti-Gm13194 antibody is: synthetic peptide directed towards the middle region of Mouse Gm13194. Synthetic peptide located within the following region: DSLYAQRKRRYDRKRSGYGGQTKPIFCKKAKTTKKIVLTLECVEPNCRSK.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn