NBP1-91950 GNG13 antibody

See related secondary antibodies

Search for all "GNG13"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GNG13

Product Description for GNG13

Rabbit anti Human GNG13.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for GNG13

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2W3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
GeneID:
51764
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 51764

Accessory Products

Proteins and/or Positive Controls

Proteins for GNG13 (3 products)

Catalog No. Species Pres. Purity   Source  

GNG13 (1-64, His-tag)

GNG13 Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €730.00
  Acris Antibodies GmbH

GNG13 (1-64, His-tag)

GNG13 Human Purified > 80 % by SDS - PAGE E. coli
20 µg / €300.00
  Acris Antibodies GmbH

Guanine nucleotide binding protein (G protein), gamma 13 (GNG13)

Guanine nucleotide binding protein (G protein), gamma 13 (GNG13) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for GNG13 (2 products)

Catalog No. Species Pres. Purity   Source  

GNG13 Lysate

Western Blot: GNG13 Lysate [NBL1-11173] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GNG13
0.1 mg / €400.00
  Novus Biologicals Inc.

GNG13 overexpression lysate

GNG13 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn