discontinued

NBP1-91950 GNG13 antibody

See related secondary antibodies

Search for all "GNG13"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human GNG13

Product Description for GNG13

Rabbit anti Human GNG13.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for GNG13

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2W3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL
GeneID:
51764
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 51764

Accessory Products

Proteins and/or Positive Controls

Proteins for GNG13 (3 products)

Catalog No. Species Pres. Purity   Source  

GNG13 (1-64, His-tag)

GNG13 Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €730.00
  Acris Antibodies GmbH

GNG13 (1-64, His-tag)

GNG13 Human Purified > 80 % by SDS - PAGE E. coli
20 µg / €300.00
  Acris Antibodies GmbH

Guanine nucleotide binding protein (G protein), gamma 13 (GNG13)

Guanine nucleotide binding protein (G protein), gamma 13 (GNG13) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for GNG13 (2 products)

Catalog No. Species Pres. Purity   Source  

GNG13 Lysate

Western Blot: GNG13 Lysate [NBL1-11173] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GNG13
0.1 mg / €400.00
  Novus Biologicals Inc.

GNG13 overexpression lysate

GNG13 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn