NBP1-68917 GNS antibody

See related secondary antibodies

Search for all "GNS"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat GNS

Product Description for GNS

Rabbit anti Rat GNS.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GNS

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Gns (glucosamine (N-acetyl)-6-sulfatase) The peptide sequence was selected from the C terminal of Gns. Peptide sequence YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV.
Background GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 299825

Accessory Products

  • LinkedIn