NBP1-91959 GPATCH8 antibody

See related secondary antibodies

Search for all "GPATCH8"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GPATCH8

Product Description for GPATCH8

Rabbit anti Human GPATCH8.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for GPATCH8

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKJ3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SIASVFKDHAEEGTSEDGTKPDEKSSDQGLQKVGDSDGSSNLDGKKEDEDPQDGGSLASTLSKLKRMKREEGAGATEPEYYHYIPPAHCKVKPN
GeneID:
23131
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 23131

Accessory Products

Proteins and/or Positive Controls

Positive controls for GPATCH8 (2 products)

Catalog No. Species Pres. Purity   Source  

GPATCH8 Lysate

Western Blot: GPATCH8 Lysate [NBL1-11216] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GPATCH8
0.1 mg / €620.00
  Novus Biologicals Inc.

GPATCH8 overexpression lysate

GPATCH8 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn