discontinued

NBP1-59406 GPR75 antibody

See related secondary antibodies

Search for all "GPR75"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat GPR75

Product Description for GPR75

Rabbit anti Human, Mouse, Rat GPR75.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR75

Product Category Primary Antibodies
Quantity 50 µg
Synonyms GPR-chr2, WI-31133
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2RC02
Immunogen:
Synthetic peptides corresponding to GPR75(G protein-coupled receptor 75) The peptide sequence was selected from the middle region of GPR75. Peptide sequence GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY.
GeneID:
10936
Background GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1894 AK314885.1 1-1894 1895-2115 AF072693.1 1834-2054
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 10936

Accessory Products

  • LinkedIn