NBP1-59406 GPR75 antibody

See related secondary antibodies

Search for all "GPR75"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat GPR75

Product Description for GPR75

Rabbit anti Human, Mouse, Rat GPR75.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR75

Product Category Primary Antibodies
Quantity 50 µg
Synonyms GPR-chr2, WI-31133
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2RC02
Immunogen:
Synthetic peptides corresponding to GPR75(G protein-coupled receptor 75) The peptide sequence was selected from the middle region of GPR75. Peptide sequence GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY.
GeneID:
10936
Background GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1894 AK314885.1 1-1894 1895-2115 AF072693.1 1834-2054
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 10936

Accessory Products

  • LinkedIn