discontinued

H00080273-B01P GRPEL1 antibody

See related secondary antibodies

Search for all "GRPEL1"

Quick Overview

Mouse anti Human, Mouse, Rat GRPEL1

H00080273-B01P

More Views

  • H00080273-B01P
  • H00080273-B01P
  • H00080273-B01P
  • H00080273-B01P

Product Description for GRPEL1

Mouse anti Human, Mouse, Rat GRPEL1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for GRPEL1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms GREPEL1, GrpE protein homolog 1, HMGE, Mt-GrpE#1
Presentation Purified
Reactivity Hu, Ms, Rt
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HAV7
Immunogen:
GRPEL1 (NP_079472.1, 1 a.a. ~ 217 a.a) full-length human protein.
AA Sequence:
MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVE KYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQ KVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
GeneID:
80273
Remarks:
Gene Accession: NM_025196.2
Add. information Mouse polyclonal antibody raised against a full-length human GRPEL1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse,Rat
Gene ID 80273

Accessory Products

Proteins and/or Positive Controls

Proteins for GRPEL1 (8 products)

Catalog No. Species Pres. Purity   Source  

GRPEL1 (28-217, His-tag)

GRPEL1 Human Purified > 90 % E. coli
0.25 mg / €750.00
  Acris Antibodies GmbH

GRPEL1 (28-217, His-tag)

GRPEL1 Human Purified > 90 % E. coli
50 µg / €300.00
  Acris Antibodies GmbH

GRPEL1

GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GRPEL1

GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GRPEL1

GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GRPEL1

GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GRPEL1

GRPEL1 Human Purified
  Novus Biologicals Inc.

GRPEL1

GRPEL1 Human Purified
  Novus Biologicals Inc.

Positive controls for GRPEL1 (2 products)

Catalog No. Species Pres. Purity   Source  

GRPEL1 293T Cell Transient Overexpression Lysate(Denatured)

GRPEL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GRPEL1 overexpression lysate

GRPEL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn