TA339367 GRPEL1 antibody

Rabbit Polyclonal Anti-GRPEL1 Antibody

See related secondary antibodies

Search for all "GRPEL1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human GRPEL1

Product Description for GRPEL1

Rabbit anti Guinea Pig, Human GRPEL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GRPEL1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms GREPEL1, GrpE protein homolog 1, HMGE, Mt-GrpE#1
Presentation Purified
Reactivity GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-GRPEL1 antibody: synthetic peptide directed towards the N terminal of human GRPEL1. Synthetic peptide located within the following region: NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD.
Application WB
Background GRPEL1 is essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL1 seems to control the nucleotide-depe
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for GRPEL1 (8 products)

Catalog No. Species Pres. Purity   Source  

GRPEL1 (28-217, His-tag)

GRPEL1 Human Purified > 90 % E. coli
0.25 mg / €750.00
  OriGene Technologies GmbH

GRPEL1 (28-217, His-tag)

GRPEL1 Human Purified > 90 % E. coli
50 µg / €300.00
  OriGene Technologies GmbH


GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


GRPEL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


GRPEL1 Human Purified
  Novus Biologicals Inc.


GRPEL1 Human Purified
  Novus Biologicals Inc.

Positive controls for GRPEL1 (2 products)

Catalog No. Species Pres. Purity   Source  

GRPEL1 293T Cell Transient Overexpression Lysate(Denatured)

GRPEL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GRPEL1 overexpression lysate

GRPEL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn