discontinued

H00002966-B01 GTF2H2 / BTF2P44 antibody

See related secondary antibodies

Search for all "GTF2H2 / BTF2P44"

Quick Overview

Mouse anti Human GTF2H2 / BTF2P44

H00002966-B01

More Views

  • H00002966-B01
  • H00002966-B01

Product Description for GTF2H2 / BTF2P44

Mouse anti Human GTF2H2 / BTF2P44.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for GTF2H2 / BTF2P44

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BTF2-p44, Basic transcription factor 2 44 kDa subunit, General transcription factor IIH polypeptide 2, General transcription factor IIH subunit 2, TFIIH, TFIIH basal transcription factor complex p44 subunit
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13888
Immunogen:
GTF2H2 (NP_001506.1, 1 a.a. ~ 395 a.a) full-length human protein.
AA Sequence:
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDL KPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIA MQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHY KELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVE CKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLH CCPGCIHKIPAPSGV
GeneID:
2966
Remarks:
Gene Accession: NM_001515.2
Add. information Mouse polyclonal antibody raised against a full-length human GTF2H2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 2966

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2H2 / BTF2P44 (2 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GTF2H2 / BTF2P44 (1 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn