discontinued

H00002966-D01 GTF2H2 / BTF2P44 antibody

See related secondary antibodies

Search for all "GTF2H2 / BTF2P44"

Quick Overview

Rabbit anti Human GTF2H2 / BTF2P44

Product Description for GTF2H2 / BTF2P44

Rabbit anti Human GTF2H2 / BTF2P44.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for GTF2H2 / BTF2P44

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms BTF2-p44, Basic transcription factor 2 44 kDa subunit, General transcription factor IIH polypeptide 2, General transcription factor IIH subunit 2, TFIIH, TFIIH basal transcription factor complex p44 subunit
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13888
Immunogen:
GTF2H2 (NP_001506.1, 1 a.a. ~ 395 a.a) full-length human protein.
AA Sequence:
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDL KPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIA MQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHY KELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVE CKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLH CCPGCIHKIPAPSGV
GeneID:
2966
Remarks:
Gene Accession: NM_001515.2
Add. information Rabbit polyclonal antibody raised against a full-length human GTF2H2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 2966

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2H2 / BTF2P44 (2 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GTF2H2 / BTF2P44 (1 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn