TA330122 GTF2H2 / BTF2P44 antibody

Rabbit Polyclonal Anti-GTF2H2 Antibody

See related secondary antibodies

Search for all "GTF2H2 / BTF2P44"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GTF2H2 / BTF2P44


More Views

  • TA330122

Product Description for GTF2H2 / BTF2P44

Rabbit anti Human GTF2H2 / BTF2P44.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GTF2H2 / BTF2P44

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms BTF2-p44, Basic transcription factor 2 44 kDa subunit, General transcription factor IIH polypeptide 2, General transcription factor IIH subunit 2, TFIIH, TFIIH basal transcription factor complex p44 subunit
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the C terminal of human GTF2H2. Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC.
Application IHC
Background GTF2 is encoded by a gene that is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spil muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of R polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length ture has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2H2 / BTF2P44 (2 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GTF2H2 / BTF2P44 (1 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn