TA339674 GTF2H2 / BTF2P44 antibody

Rabbit Polyclonal Anti-Gtf2h2 Antibody

See related secondary antibodies

Search for all "GTF2H2 / BTF2P44"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GTF2H2 / BTF2P44

Product Description for GTF2H2 / BTF2P44

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GTF2H2 / BTF2P44.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GTF2H2 / BTF2P44

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BTF2-p44, Basic transcription factor 2 44 kDa subunit, General transcription factor IIH polypeptide 2, General transcription factor IIH subunit 2, TFIIH, TFIIH basal transcription factor complex p44 subunit
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13888
Immunogen:
The immunogen for Anti-Gtf2h2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Gtf2h2. Synthetic peptide located within the following region: SLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKP.
GeneID:
2966
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2H2 / BTF2P44 (2 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GTF2H2 / BTF2P44

GTF2H2 / BTF2P44 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GTF2H2 / BTF2P44 (1 products)

Catalog No. Species Pres. Purity   Source  

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)

GTF2H2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn