discontinued

H00002969-M01 GTF2I / TFII-I antibody

See related secondary antibodies

Search for all "GTF2I / TFII-I"

Quick Overview

Mouse anti Human GTF2I / TFII-I 3E2

H00002969-M01

More Views

  • H00002969-M01
  • H00002969-M01
  • H00002969-M01

Product Description for GTF2I / TFII-I

Mouse anti Human GTF2I / TFII-I 3E2.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for GTF2I / TFII-I

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BAP-135, BAP135, Bruton tyrosine kinase-associated protein 135, GTFII-I, General transcription factor II-I, SPIN, SRF-Phox1-interacting protein, WBSCR6, Williams-Beuren syndrome chromosomal region 6 protein
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, P, WB
Clonality Monoclonal
Clone 3E2
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P78347
Immunogen:
GTF2I (AAH04472, 36 a.a. ~ 275 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIET LRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRP FLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGN EGTEMEVPAEG*
GeneID:
2969
Remarks:
Gene Accession: BC004472
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant GTF2I.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,IHC-P,S-ELISA,WB-Re,WB-Ti
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2969

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2I / TFII-I (7 products)

Catalog No. Species Pres. Purity   Source  

GTF2I / TFII-I

GTF2I / TFII-I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

GTF2I / TFII-I

GTF2I / TFII-I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

GTF2I / TFII-I

GTF2I / TFII-I Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

GTF2I / TFII-I

GTF2I / TFII-I Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

GTF2I / TFII-I

GTF2I / TFII-I Human Purified
  Abnova Taiwan Corp.

GTF2I / TFII-I

GTF2I / TFII-I Human Purified
  Abnova Taiwan Corp.

GTF2I / TFII-I

GTF2I / TFII-I Human Purified
  Abnova Taiwan Corp.

Positive controls for GTF2I / TFII-I (1 products)

Catalog No. Species Pres. Purity   Source  

GTF2I 293T Cell Transient Overexpression Lysate(Denatured)

GTF2I 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn