TA329688 GTF2I / TFII-I antibody

Rabbit Polyclonal Anti-GTF2I Antibody

See related secondary antibodies

Search for all "GTF2I / TFII-I"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GTF2I / TFII-I


More Views

  • TA329688
  • TA329688
  • TA329688

Product Description for GTF2I / TFII-I

Rabbit anti Human GTF2I / TFII-I.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GTF2I / TFII-I

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms BAP-135, BAP135, Bruton tyrosine kinase-associated protein 135, GTFII-I, General transcription factor II-I, SPIN, SRF-Phox1-interacting protein, WBSCR6, Williams-Beuren syndrome chromosomal region 6 protein
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-GTF2I antibody: synthetic peptide directed towards the N terminal of human GTF2I. Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH.
Application WB
Background GTF2I encodes a multifunctiol phosphoprotein with roles in transcription and sigl transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. The exon(s) encoding 5' UTR has not been fully defined, but this gene is known to contain at least 34 exons, and its altertive splicing generates 4 transcript variants.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2I / TFII-I (7 products)

Catalog No. Species Pres. Purity   Source  


GTF2I / TFII-I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


GTF2I / TFII-I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


GTF2I / TFII-I Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


GTF2I / TFII-I Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


GTF2I / TFII-I Human Purified
  Abnova Taiwan Corp.


GTF2I / TFII-I Human Purified
  Abnova Taiwan Corp.


GTF2I / TFII-I Human Purified
  Abnova Taiwan Corp.

Positive controls for GTF2I / TFII-I (1 products)

Catalog No. Species Pres. Purity   Source  

GTF2I 293T Cell Transient Overexpression Lysate(Denatured)

GTF2I 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn