H00112495-B01P GTF3C6 antibody

See related secondary antibodies

Search for all "GTF3C6"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human GTF3C6

H00112495-B01P

Product Description for GTF3C6

Mouse anti Human GTF3C6.
Product is tested for Western blot / Immunoblot.

Properties for GTF3C6

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C6orf51, TFIIIC35, bA397G5.3
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969F1
Immunogen:
GTF3C6 (NP_612417.1, 1 a.a. ~ 213 a.a) full-length human protein.
AA Sequence:
MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIF EENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICNFLHENEDEEV VASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
GeneID:
112495
Add. information Mouse polyclonal antibody raised against a full-length human GTF3C6 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF3C6 (2 products)

Catalog No. Species Pres. Purity   Source  

GTF3C6 (1-213, His-tag)

GTF3C6 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

GTF3C6 (1-213, His-tag)

GTF3C6 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH

Positive controls for GTF3C6 (2 products)

Catalog No. Species Pres. Purity   Source  

GTF3C6 Lysate

Western Blot: GTF3C6 Lysate [NBL1-11397] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GTF3C6
0.1 mg / €400.00
  Novus Biologicals Inc.

GTF3C6 overexpression lysate

GTF3C6 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn