H00121355-B01P GTSF1 antibody

See related secondary antibodies

Search for all "GTSF1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human GTSF1

H00121355-B01P

Product Description for GTSF1

Mouse anti Human GTSF1.
Product is tested for Western blot / Immunoblot.

Properties for GTSF1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FAM112B, FLJ32942
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WW33
Immunogen:
GTSF1 (NP_653195.1, 1 a.a. ~ 167 a.a) full-length human protein.
AA Sequence:
MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSC IEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFAWGTTHYSDNNSPASNIVTEHKNNLASGMRVPK SLPYVLPWKNNGNAQ
GeneID:
121355
Add. information Mouse polyclonal antibody raised against a full-length human GTSF1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for GTSF1 (3 products)

Catalog No. Species Pres. Purity   Source  

Gametocyte specific factor 1 (GTSF1)

Gametocyte specific factor 1 (GTSF1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

GTSF1 (1-167, His-tag)

GTSF1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

GTSF1 (1-167, His-tag)

GTSF1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Positive controls for GTSF1 (1 products)

Catalog No. Species Pres. Purity   Source  

GTSF1 Lysate

Western Blot: GTSF1 Lysate [NBL1-11405] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for GTSF1.
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn