NBP1-83934 GTSF1 antibody

See related secondary antibodies

Search for all "GTSF1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GTSF1

NBP1-83934

More Views

  • NBP1-83934

Product Description for GTSF1

Rabbit anti Human GTSF1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GTSF1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WW33
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
GeneID:
121355
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 121355

Accessory Products

Proteins and/or Positive Controls

Proteins for GTSF1 (3 products)

Catalog No. Species Pres. Purity   Source  

Gametocyte specific factor 1 (GTSF1)

Gametocyte specific factor 1 (GTSF1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

GTSF1 (1-167, His-tag)

GTSF1 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

GTSF1 (1-167, His-tag)

GTSF1 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Positive controls for GTSF1 (1 products)

Catalog No. Species Pres. Purity   Source  

GTSF1 Lysate

Western Blot: GTSF1 Lysate [NBL1-11405] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for GTSF1.
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn