NBP1-94184 H2BFM antibody

See related secondary antibodies

Search for all "H2BFM"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human H2BFM

NBP1-94184

More Views

  • NBP1-94184

Product Description for H2BFM

Rabbit anti Human H2BFM.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections.

Properties for H2BFM

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6G8F7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HATIPKCPPLPWSPTVTLCSCYLMAAASAMAEASSETTSEEGQSIQEP
GeneID:
2864360
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 2864360

Accessory Products

  • LinkedIn