TA332072 Hairless / HR antibody

Rabbit Polyclonal Anti-HR Antibody

See related secondary antibodies

Search for all "Hairless / HR"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Hairless / HR

Product Description for Hairless / HR

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Hairless / HR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Hairless / HR

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Protein hairless
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43593
Immunogen:
The immunogen for Anti-HR Antibody: synthetic peptide directed towards the N terminal of human HR. Synthetic peptide located within the following region: GLPPEHPCDWPLTPHPWVYSGGQPKVPSAFSLGSKGFYYKDPSIPRLAKE.
GeneID:
55806
Application WB
Background HR is a protein whose function has been linked to hair growth. A similar protein in rat functions as a transcriptiol corepressor for thyroid hormone and interacts with histone deacetylases. Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Hairless / HR (4 products)

Catalog No. Species Pres. Purity   Source  

Hairless / HR (transcript variant 1)

Hairless / HR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Hairless / HR (transcript variant 2)

Hairless / HR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Hairless / HR

Hairless / HR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Hairless / HR

Hairless / HR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Hairless / HR (2 products)

Catalog No. Species Pres. Purity   Source  

HR overexpression lysate

HR overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

HR overexpression lysate

HR overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn