discontinued

NBP1-62552 HAS3 antibody

See related secondary antibodies

Search for all "HAS3"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat HAS3

Product Description for HAS3

Rabbit anti Human, Mouse, Rat HAS3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HAS3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WTZ0
Immunogen:
Synthetic peptides corresponding to HAS3(hyaluronan synthase 3), The peptide sequence was selected from the C terminal of HAS3. Peptide sequence SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR.
GeneID:
3038
Background HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3038

Accessory Products

  • LinkedIn