discontinued

NBP1-57178 HCC1 antibody

See related secondary antibodies

Search for all "HCC1"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat HCC1

Product Description for HCC1

Rabbit anti Human, Mouse, Rat HCC1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HCC1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5QP22
Immunogen:
Synthetic peptides corresponding to RBM39(RNA binding motif protein 39) The peptide sequence was selected from the middle region of RBM39. Peptide sequence FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE.
Background RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn